RNF138 Rabbit Polyclonal Antibody

CAT#: TA331919

Rabbit Polyclonal Anti-RNF138 Antibody

Product Images

WB Suggested Anti-RNF138 Antibody Titration: 0.2-1 ug/ml; Positive Control: Transfected 293T

• 

  Host: Rabbit; Target Name: RNF138; Sample Tissue: Jurkat; Antibody Dilution: 1.0ug/ml; RNF138 is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RNF138 Antibody: synthetic peptide directed towards the C terminal of human RNF138. Synthetic peptide located within the following region: LFQIVPVTCPICVSLPWGDPSQITRNFVSHLNQRHQFDYGEFVNLQLDEE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: ring finger protein 138
• Database Link:
  NP_057355
  Entrez Gene 51444 Human
  UniProt ID Q8WVD3
• Background: RNF138 contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-DNA and protein-protein interactions.The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-DNA and protein-protein interactions. Alternatively spliced transcript variants encoding distinct isoforms have been observed.
• Synonyms: hNARF; HSD-4; NARF; STRIN
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 92%