ABHD14A Rabbit Polyclonal Antibody

CAT#: TA331954

Rabbit Polyclonal Anti-ABHD14A Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ABHD14A"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution IHC, WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-ABHD14A Antibody is: synthetic peptide directed towards the middle region of Human ABHD14A. Synthetic peptide located within the following region: DLPGFGNSAPSKEASTEAGRAALLERALRDLEVQNAVLVSPSLSGHYALP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 30 kDa
Gene Name abhydrolase domain containing 14A
Background ABHD14A play a possible role in granule neuron development.
Synonyms DORZ1
Note Immunogen sequence homology: Pig: 100%; Horse: 100%; Human: 100%; Dog: 93%; Guinea pig: 93%; Rat: 86%; Mouse: 86%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.