TSPAN1 Rabbit Polyclonal Antibody

CAT#: TA332053

Rabbit Polyclonal Anti-TSPAN1 Antibody

Product Images

WB Suggested Anti-TSPAN1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TSPAN1 Antibody: synthetic peptide directed towards the middle region of human TSPAN1. Synthetic peptide located within the following region: TMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 26 kDa
• Gene Name: tetraspanin 1
• Database Link:
  NP_005718
  Entrez Gene 10103 Human
  UniProt ID O60635
• Background: The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.
• Synonyms: NET1; TM4C; TM4SF
• Note: Immunogen sequence homology: Human: 100%; Rat: 93%; Dog: 91%; Bovine: 90%; Pig: 79%; Guinea pig: 77%

Reference Data

• Protein Families: Transmembrane