PMP70 (ABCD3) Rabbit Polyclonal Antibody

CAT#: TA332115

Rabbit Polyclonal Anti-ABCD3 Antibody

Product Images

WB Suggested Anti-ABCD3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human Small Intestine

• 

  Host: Rabbit; Target Name: ABCD3; Sample Tissue: Human HepG2; Antibody Dilution: 1.0ug/ml; ABCD3 is supported by BioGPS gene expression data to be expressed in HepG2

• 

  Host: Rabbit; Target Name: ABCD3; Sample Tissue: Human 721_B; Antibody Dilution: 1.0ug/ml; ABCD3 is supported by BioGPS gene expression data to be expressed in 721_B

• 

  Host: Rabbit; Target Name: ABCD3; Sample Tissue: Human Hela; Antibody Dilution: 1.0ug/ml; ABCD3 is supported by BioGPS gene expression data to be expressed in HeLa

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ABCD3 Antibody: synthetic peptide directed towards the N terminal of human ABCD3. Synthetic peptide located within the following region: LKYGLNELKLCFRVRLTKYLYEEYLQAFTYYKMGNLDNRIANPDQLLTQD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 75 kDa
• Gene Name: ATP binding cassette subfamily D member 3
• Database Link:
  NP_002849
  Entrez Gene 5825 Human
  UniProt ID P28288
• Background: The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter. This peroxisomal membrane protein likely plays an important role in peroxisome biogenesis. Mutations have been associated with some forms of Zellweger syndrome, a heterogeneous group of peroxisome assembly disorders. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008]
• Synonyms: ABC43; CBAS5; PMP70; PXMP1; ZWS2
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%; Zebrafish: 93%; Yeast: 77%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: ABC transporters