IQSEC2 Rabbit Antibody

CAT#: TA332194

Rabbit Polyclonal Anti-IQSEC2 Antibody

Specifications

Product Data

• Reactivities: Mouse, Human, Rat, Dog, Bovine, Pig, Horse, Rabbit, Guinea pig, Zebrafish
• Host: Rabbit
• Isotype: IgG
• Immunogen: The immunogen for Anti-IQSEC2 Antibody is: synthetic peptide directed towards the middle region of Human IQSEC2. Synthetic peptide located within the following region: ARTIQTAFRQYRMNKNFERLRSSASESRMSRRIILSNMRMQFSFEEYEKA
• Formulation: Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 163 kDa
• Database Link:
  NP_001104595
  Entrez Gene 23096 Human
• Background: This gene encodes a guanine nucleotide exchange factor for the ARF family of small GTP-binding proteins. The encoded protein is a component of the postsynaptic density at excitatory synapses, and may play a critical role in cytoskeletal and synaptic organization through the activation of selected ARF substrates including ARF1 and ARF6. Mutations in this gene have been implicated in nonsyndromic X-linked mental retardation.
• Synonyms: BRAG1; MRX1
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Pathways: Endocytosis