AMIGO3 Rabbit Polyclonal Antibody

CAT#: TA333345

Rabbit Polyclonal Anti-AMIGO3 Antibody

Product Images

WB Suggested Anti-AMIGO3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-AMIGO3 Antibody: synthetic peptide directed towards the N terminal of human AMIGO3. Synthetic peptide located within the following region: MTWLVLLGTLLCMLRVGLGTPDSEGFPPRALHNCPYKCICAADLLSCTGL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: adhesion molecule with Ig-like domain 3
• Database Link:
  NP_942015
  Entrez Gene 386724 Human
  UniProt ID Q86WK7
• Background: AMIGO3 may mediate heterophilic cell-cell interaction. AMIGO3 may contribute to signal transduction through its intracellular domain.
• Synonyms: ALI3; AMIGO-3
• Note: Immunogen sequence homology: Human: 100%; Pig: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Transmembrane