COA8 Rabbit Polyclonal Antibody

CAT#: TA333613

Rabbit Polyclonal Anti-APOPT1 Antibody

Product Images

Host: Rabbit; Target Name: APOPT1; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0 ug/ml.

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-APOPT1 Antibody is: synthetic peptide directed towards the C-terminal region of Human APOPT1. Synthetic peptide located within the following region: KEFLSKNFQKHMYYNRDWYKRNFAITFFMGKVALERIWNKLKQKQKKRSN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: apoptogenic 1, mitochondrial
• Database Link:
  NP_115750
  Entrez Gene 84334 Human
  UniProt ID Q96IL0
• Background: APOPT1 plays a role in the regulation of apoptosis. It mediates mitochondria-induced cell death in vascular smooth muscle cells through the release of cytochrome c from mitochondria, followed by the activation of the caspase cascade.
• Synonyms: APOP; APOP1; C14orf153
• Note: Immunogen sequence homology: Human: 100%; Horse: 82%; Bovine: 82%

Reference Data

• Protein Families: Secreted Protein