SGEF (ARHGEF26) Rabbit Polyclonal Antibody

CAT#: TA333805

Rabbit Polyclonal Anti-ARHGEF26 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ARHGEF26"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-ARHGEF26 Antibody: synthetic peptide directed towards the N terminal of human SGEF. Synthetic peptide located within the following region: MDGESEVDFSSNSITPLWRRRSIPQPHQVLGRSKPRPQSYQSPNGLLITD
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 97 kDa
Gene Name Rho guanine nucleotide exchange factor 26
Background SGEF activates RhoG GTPase by promoting the exchange of GDP by GTP. SGEF is required for the formation of membrane ruffles during macropinocytosis. SGEF is also required for the formation of cup-like structures during trans-endothelial migration of leukocyte.
Synonyms CSGEF; HMFN1864; SGEF
Note Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Yeast: 90%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.