xCT (SLC7A11) Rabbit Polyclonal Antibody

CAT#: TA333870

Rabbit Polyclonal Anti-SLC7A11 Antibody

Product Images

WB Suggested Anti-SLC7A11 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: THP-1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC7A11 Antibody: synthetic peptide directed towards the middle region of human SLC7A11. Synthetic peptide located within the following region: KGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: solute carrier family 7 member 11
• Database Link:
  NP_055146
  Entrez Gene 23657 Human
  UniProt ID Q9UPY5
• Background: SLC7A11 is a member of a heteromeric Na(+)-independent anionic amino acid transport system highly specific for cystine and glutamate. In this system, designated system Xc(-), the anionic form of cystine is transported in exchange for glutamate.
• Synonyms: CCBR1; xCT
• Note: Immunogen sequence homology: Human: 100%; Dog: 92%; Pig: 92%; Horse: 92%; Sheep: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 92%; Rat: 85%; Mouse: 85%

Reference Data

• Protein Families: Druggable Genome, Transmembrane