ZNF217 Rabbit Polyclonal Antibody

CAT#: TA333915

Rabbit Polyclonal Anti-ZNF217 Antibody

Product Images

WB Suggested Anti-ZNF217 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Stomach

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZNF217 Antibody: synthetic peptide directed towards the N terminal of human ZNF217. Synthetic peptide located within the following region: SQTFTHSEDLNKHVLMQHRPTLCEPAVLRVEAEYLSPLDKSQVRTEPPKE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 115 kDa
• Gene Name: zinc finger protein 217
• Database Link:
  NP_006517
  Entrez Gene 7764 Human
  UniProt ID O75362
• Background: ZNF217 may be involved in transcriptional regulation.
• Synonyms: ZABC1
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 92%

Reference Data

• Protein Families: Transcription Factors