INPP5A Rabbit Polyclonal Antibody

CAT#: TA333940

Rabbit Polyclonal Anti-INPP5A Antibody

Product Images

WB Suggested Anti-INPP5A Antibody; Titration: 1.0 ug/ml; Positive Control: HT1080 Whole CellINPP5A is supported by BioGPS gene expression data to be expressed in HT1080

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-INPP5A Antibody is: synthetic peptide directed towards the C-terminal region of Human INPP5A. Synthetic peptide located within the following region: VVKLIFRESDNDRKVMLQLEKKLFDYFNQEVFRDNNGTALLEFDKELSVF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: inositol polyphosphate-5-phosphatase A
• Database Link:
  NP_005530
  Entrez Gene 3632 Human
  UniProt ID Q14642
• Background: The protein encoded by this gene is a membrane-associated type I inositol 1,4,5-trisphosphate (InsP3) 5-phosphatase. InsP3 5-phosphatases hydrolyze Ins(1,4,5)P3, which mobilizes intracellular calcium and acts as a second messenger mediating cell responses to various stimulation.
• Synonyms: 5PTASE
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Mouse: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system