SLC9A3 Rabbit Polyclonal Antibody

CAT#: TA333979

Rabbit Polyclonal Anti-SLC9A3 Antibody

Product Images

WB Suggested Anti-SLC9A3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: COLO205 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC9A3 Antibody: synthetic peptide directed towards the middle region of human SLC9A3. Synthetic peptide located within the following region: AEDMVTHHTLQQYLYKPRQEYKHLYSRHELTPTEDEKQDREIFHRTMRKR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 93 kDa
• Gene Name: solute carrier family 9 member A3
• Database Link:
  NP_004165
  Entrez Gene 6550 Human
  UniProt ID P48764
• Background: SLC9A3 is involved in pH regulation to eliminate acids generated by active metabolism or to counter adverse environmental conditions. SLC9A3 is the major proton extruding system driven by the inward sodium ion chemical gradient. SLC9A3 plays an important role in signal transduction.
• Synonyms: NHE3
• Note: Immunogen sequence homology: Human: 100%; Dog: 92%; Rat: 92%; Mouse: 92%; Pig: 77%; Sheep: 77%; Bovine: 77%; Rabbit: 77%

Reference Data

• Protein Families: Druggable Genome, Transmembrane