LAT3 (SLC43A1) Rabbit Polyclonal Antibody
Other products for "SLC43A1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-SLC43A1 Antibody: synthetic peptide directed towards the middle region of human SLC43A1. Synthetic peptide located within the following region: AVNKMLEYLVTGGQEHETNEQQQKVAETVGFYSSVFGAMQLLCLLTCPLI |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 61 kDa |
Gene Name | solute carrier family 43 member 1 |
Database Link | |
Background | SLC43A1 belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids.SLC43A1 belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids (Babu et al., 2003 [PubMed 12930836]). [supplied by OMIM] |
Synonyms | LAT3; PB39; POV1; R00504 |
Note | Immunogen sequence homology: Human: 100%; Rat: 79%; Mouse: 79% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.