Sodium Iodide Symporter (SLC5A5) Rabbit Polyclonal Antibody

CAT#: TA334164

Rabbit Polyclonal Anti-SLC5A5 Antibody

Product Images

WB Suggested Anti-SLC5A5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: COLO205 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC5A5 Antibody: synthetic peptide directed towards the N terminal of human SLC5A5. Synthetic peptide located within the following region: TAVGGMKAVVWTDVFQVVVMLSGFWVVLARGVMLVGGPRQVLTLAQNHSR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 69 kDa
• Gene Name: solute carrier family 5 member 5
• Database Link:
  NP_000444
  Entrez Gene 6528 Human
  UniProt ID Q92911
• Background: The sodium-iodide symporter (NIS, or SLC5A5) is a key plasma membrane protein that mediates active I- uptake in thyroid, lactating breast, and other tissues with an electrogenic stoichiometry of 2 Na+ per I-. In thyroid, NIS-mediated I- uptake is the first step in the biosynthesis of iodine-containing thyroid hormones.
• Synonyms: NIS; TDH1
• Note: Immunogen sequence homology: Human: 100%; Rat: 93%; Horse: 79%; Mouse: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane