USP3 Rabbit Polyclonal Antibody

CAT#: TA334220

Rabbit Polyclonal Anti-USP3 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "USP3"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-USP3 antibody: synthetic peptide directed towards the N terminal of human USP3. Synthetic peptide located within the following region: GRYVNGHAKKHYEDAQVPLTNHKKSEKQDKVQHTVCMDCSSYSTYCYRCD
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 59 kDa
Gene Name ubiquitin specific peptidase 3
Background USP3 is a novel human ubiquitin-specific protease. The USP3 protein is a functional ubiquitin-specific protease in vitro, and is able to inhibit ubiquitin-dependent degradation of both an N-end Rule substrate and abnormal endogenous proteins in yeast. USP3 is also only the second known ubiquitin-specific protease capable of efficiently cleaving a ubiquitin-proline bond.
Synonyms SIH003; UBP
Note Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 92%; Rat: 92%; Horse: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 92%; Mouse: 85%
Reference Data
Protein Families Druggable Genome, Protease

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.