NFE2L3 Rabbit Polyclonal Antibody

CAT#: TA334238

Rabbit Polyclonal Anti-NFE2L3 Antibody

Product Images

WB Suggested Anti-NFE2L3 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NFE2L3 antibody: synthetic peptide directed towards the middle region of human NFE2L3. Synthetic peptide located within the following region: NPEQTLPGTNLTGFLSPVDNHMRNLTSQDLLYDLDINIFDEINLMSLATE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 76 kDa
• Gene Name: nuclear factor, erythroid 2 like 3
• Database Link:
  NP_004280
  Entrez Gene 9603 Human
  UniProt ID Q9Y4A8
• Background: NFE2L3 activates erythroid-specific, globin gene expression.
• Synonyms: NRF3
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Rabbit: 92%; Pig: 86%; Bovine: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Transcription Factors, Transmembrane