SLC6A18 Rabbit Polyclonal Antibody

CAT#: TA334626

Rabbit Polyclonal Anti-SLC6A18 Antibody

Product Images

WB Suggested Anti-SLC6A18 Antibody Titration: 1.25 ug/ml; Positive Control: Jurkat cell lysate

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SLC6A18 antibody: synthetic peptide directed towards the middle region of human SLC6A18. Synthetic peptide located within the following region: MHLNATWPKRVAQLPLKACLLEDFLDKSASGPGLAFVVFTETDLHMPGAP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 69 kDa
• Gene Name: solute carrier family 6 member 18
• Database Link:
  NP_872438
  Entrez Gene 348932 Human
  UniProt ID Q96N87
• Background: The function remains unknown.
• Synonyms: Xtrp2
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%

Reference Data

• Protein Families: Druggable Genome, Transmembrane