EXOC7 Rabbit Polyclonal Antibody

CAT#: TA334943

Rabbit Polyclonal Anti-EXOC7 Antibody

Product Images

Host: Rabbit; Target Name: EXOC7; Sample Tissue: Breast Tumor lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EXOC7 antibody is: synthetic peptide directed towards the C-terminal region of Human EXOC7. Synthetic peptide located within the following region: FLHNNYNYILKSLEKSELIQLVAVTQKTAERSYREHIEQQIQTYQRSWLK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 63 kDa
• Gene Name: exocyst complex component 7
• Database Link:
  AAH18466
  Entrez Gene 23265 Human
  UniProt ID Q9UPT5
• Background: The protein encoded by this gene is a component of the exocyst complex. The exocyst complex plays a critical role in vesicular trafficking and the secretory pathway by targeting post-Golgi vesicles to the plasma membrane. The encoded protein is required for assembly of the exocyst complex and docking of the complex to the plasma membrane. The encoded protein may also play a role in pre-mRNA splicing through interactions with pre-mRNA-processing factor 19. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 4.
• Synonyms: 2-5-3p; DKFZp686J04253; EX070; EXO70; Exo70p; EXOC1; exocyst complex component 7; FLJ40965; FLJ46415; YJL085W
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Horse: 93%; Rabbit: 93%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Insulin signaling pathway