ETFB Rabbit Polyclonal Antibody

CAT#: TA334947

Rabbit Polyclonal Anti-ETFB Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ETFB"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ETFB antibody is: synthetic peptide directed towards the C-terminal region of Human ETFB. Synthetic peptide located within the following region: PQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPRYAT
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 28 kDa
Gene Name electron transfer flavoprotein beta subunit
Background ETFB is the electron-transfer-flavoprotein, beta polypeptide, which shuttles electrons between primary flavoprotein dehydrogenases involved in mitochondrial fatty acid and amino acid catabolism and the membrane-bound electron transfer flavoprotein ubiquinone oxidoreductase. The gene deficiencies have been implicated in type II glutaricaciduria.
Synonyms FP585; MADD
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Zebrafish: 93%; Yeast: 91%; Rabbit: 86%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.