GPR177 (WLS) Rabbit Polyclonal Antibody

CAT#: TA335293

Rabbit Polyclonal Anti-GPR177 Antibody

Product Images

WB Suggested Anti-GPR177 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GPR177 antibody: synthetic peptide directed towards the middle region of human GPR177. Synthetic peptide located within the following region: DIRLVGIHQNGGFTKVWFAMKTFLTPSIFIIMVWYWRRITMMSRPPVLLE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 62 kDa
• Gene Name: wntless Wnt ligand secretion mediator
• Database Link:
  NP_001002292
  Entrez Gene 79971 Human
  UniProt ID Q5T9L3
• Background: GPR177 has signal transducer activity. It is positive regulation of I-kappaB kinase/NF-kappaB cascade.
• Synonyms: C1orf139; EVI; GPR177; mig-14; MRP
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transmembrane