IRF5 Rabbit Polyclonal Antibody

CAT#: TA335428

Rabbit Polyclonal Anti-IRF5 Antibody

Product Images

WB Suggested Anti-IRF5 Antibody Titration: 2.5 ug/ml; ELISA Titer: 1: 312500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-IRF5 Antibody: synthetic peptide directed towards the N terminal of human IRF5. Synthetic peptide located within the following region: PTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: interferon regulatory factor 5
• Database Link:
  NP_116032
  Entrez Gene 3663 Human
  UniProt ID Q13568
• Background: IRF5 is a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity. Members of the IRF family are characterized by a conserved N-terminal DNA-binding domain containing tryptophan (W) repeats. Alternative splice variants encoding different isoforms exist.
• Synonyms: SLEB10
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Guinea pig: 93%; Zebrafish: 77%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Toll-like receptor signaling pathway