ERGIC2 Rabbit Polyclonal Antibody

CAT#: TA335553

Rabbit Polyclonal Anti-ERGIC2 Antibody

Product Images

WB Suggested Anti-ERGIC2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ERGIC2 Antibody: synthetic peptide directed towards the middle region of human ERGIC2. Synthetic peptide located within the following region: TVVPTKLHTYKISADTHQFSVTERERIINHAAGSHGVSGIFMKYDLSSLM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: ERGIC and golgi 2
• Database Link:
  NP_057654
  Entrez Gene 51290 Human
  UniProt ID Q96RQ1
• Background: ERGIC2 belongs to the ERGIC family.It possible play role in transport between endoplasmic reticulum and Golgi.
• Synonyms: cd002; CDA14; Erv41; PTX1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Zebrafish: 79%