DC2L1 (DYNC2LI1) Rabbit Polyclonal Antibody
Other products for "DYNC2LI1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-DYNC2LI1 Antibody is: synthetic peptide directed towards the C-terminal region of Human DYNC2LI1. Synthetic peptide located within the following region: EKLFPPKSINTLKDIKDPARDPQYAENEVDEMRIQKDLELEQYKRSSSKS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 39 kDa |
Gene Name | dynein cytoplasmic 2 light intermediate chain 1 |
Database Link | |
Background | DYNC2LI1 may function as a motor for intraflagellar retrograde transport and functions in cilia biogenesis. |
Synonyms | CGI-60; D2LIC; LIC3; SRTD15 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Rat: 92%; Rabbit: 86%; Mouse: 85%; Pig: 79%; Guinea pig: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.