DKKL1 Rabbit Polyclonal Antibody

CAT#: TA335625

Rabbit Polyclonal Anti-DKKL1 Antibody

Product Images

WB Suggested Anti-DKKL1 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-DKKL1 Antibody: synthetic peptide directed towards the C terminal of human DKKL1. Synthetic peptide located within the following region: DALEGGHWLSEKRHRLQAIRDGLRKGTHKDVLEEGTESSSHSRLSPRKTH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: dickkopf like acrosomal protein 1
• Database Link:
  NP_055234
  Entrez Gene 27120 Human
  UniProt ID Q9UK85
• Background: The dickkopf protein family interacts with the Wnt signaling pathway and its members are characterized by two conserved cysteine-rich domains. DKKL1 is a secreted protein that has high similarity to the N-terminus of the dickkopf-3 protein and moderate similarity to that protein's C-terminus though the C-terminal cysteine residues are not conserved.The dickkopf protein family interacts with the Wnt signaling pathway and its members are characterized by two conserved cysteine-rich domains. This gene encodes a secreted protein that has high similarity to the N-terminus of the dickkopf-3 protein and moderate similarity to that protein's C-terminus though the C-terminal cysteine residues are not conserved.
• Synonyms: CT34; SGY; SGY-1; SGY1
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 86%; Dog: 77%

Reference Data

• Protein Families: ES Cell Differentiation/IPS, Secreted Protein, Transmembrane