STAG3 Rabbit Polyclonal Antibody

CAT#: TA335651

Rabbit Polyclonal Anti-STAG3 Antibody

Product Images

WB Suggested Anti-STAG3 Antibody Titration: 0.2-1 ug/ml; Positive Control: 721_B cell lysate. STAG3 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-STAG3 Antibody: synthetic peptide directed towards the middle region of human STAG3. Synthetic peptide located within the following region: VPHQVILPALTLVYFSILWTLTHISKSDASQKQLSSLRDRMVAFCELCQS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 135 kDa
• Gene Name: stromal antigen 3
• Database Link:
  NP_036579
  Entrez Gene 10734 Human
  UniProt ID Q9UJ98
• Background: STAG3 is a meiosis specific component of cohesin complex. The cohesin complex is required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The meiosis-specific cohesin complex probably replaces mitosis specific cohesin complex when it dissociates from chromatin during prophase I.
• Synonyms: POF8
• Note: Immunogen Sequence Homology: Human: 100%; Zebrafish: 83%

Reference Data

• Protein Pathways: Oocyte meiosis