HEXIM1 Rabbit Polyclonal Antibody

CAT#: TA335686

Rabbit Polyclonal Anti-HEXIM1 Antibody

Product Images

WB Suggested Anti-HEXIM1 Antibody Titration: 0.6 ug/ml; ELISA Titer: 1:12500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-HEXIM1 Antibody: synthetic peptide directed towards the C terminal of human HEXIM1. Synthetic peptide located within the following region: LESKRLGGDDARVRELELELDRLRAENLQLLTENELHRQQERAPLSKFGD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: hexamethylene bis-acetamide inducible 1
• Database Link:
  NP_006451
  Entrez Gene 10614 Human
  UniProt ID O94992
• Background: HEXIM1 expression is induced by hexamethylene-bis-acetamide in vascular smooth muscle cells. The function of this protein is not yet known.
• Synonyms: CLP1; EDG1; HIS1; MAQ1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 93%; Yeast: 82%; Zebrafish: 80%

Reference Data

• Protein Families: Transcription Factors