CIAO1 Rabbit Polyclonal Antibody

CAT#: TA335736

Rabbit Polyclonal Anti-CIAO1 Antibody

Product Images

WB Suggested Anti-CIAO1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: 721_B cell lysateCIAO1 is supported by BioGPS gene expression data to be expressed in 721_B

• 

  Host: Rabbit; Target Name: CIAO1; Sample Tissue: MCF7; Antibody Dilution: 1.0 ug/ml. CIAO1 is supported by BioGPS gene expression data to be expressed in MCF7

• 

  Host: Rabbit; Target Name: CIAO1; Sample Tissue: 721_B; Antibody Dilution: 1.0 ug/ml. CIAO1 is supported by BioGPS gene expression data to be expressed in 721_B

• 

  Rabbit Anti-CIAO1 Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue; Observed Staining: Cytoplasmic in alveolar type I cells; Primary Antibody Concentration: 1:100; Other Working Concentrations: 1/600; Secondary Antibody: Donkey anti-Rabbit-Cy3; Secondary Antibody Concentration: 1:200; Magnification: 20X; Exposure Time: 0.5 - 2.0 sec;

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CIAO1 Antibody: synthetic peptide directed towards the middle region of human CIAO1. Synthetic peptide located within the following region: SVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREEEDDWVCCATLEGH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: cytosolic iron-sulfur assembly component 1
• Database Link:
  NP_004795
  Entrez Gene 9391 Human
  UniProt ID O76071
• Background: CIAO1 belongs to the WD repeat CIA1 family. It seems to specifically modulate the transactivation activity of WT1.
• Synonyms: CIA1; WDR39
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Yeast: 93%

Reference Data

• Protein Families: Transcription Factors