Recoverin (RCVRN) Rabbit Polyclonal Antibody

CAT#: TA335802

Rabbit Polyclonal Anti-RCV1 Antibody

Product Images

WB Suggested Anti-RCV1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RCV1 Antibody: synthetic peptide directed towards the C terminal of human RCV1. Synthetic peptide located within the following region: KMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: recoverin
• Database Link:
  NP_002894
  Entrez Gene 5957 Human
  UniProt ID P35243
• Background: RCV1 is a member of the recoverin family of neuronal calcium sensors. RCV1 contains three calcium-binding EF-hand domains and may prolong the termination of the phototransduction cascade in the retina by blocking the phosphorylation of photo-activated rhodopsin. Recoverin may be the antigen responsible for cancer-associated retinopathy.The protein encoded by this gene contains four calcium-binding EF-hand domains and belongs to the recoverin family of neuronal calcium sensors. Recoverin may prolong the termination of the phototransduction cascade by blocking the phosphorylation of photo-activated rhodopsin. Recoverin may be the antigen responsible for cancer-associated retinopathy; an autoimmune disease of the retina caused by a tumor in another tissue.
• Synonyms: RCV1
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 86%; Bovine: 86%; Rat: 85%; Dog: 79%; Rabbit: 79%; Pig: 75%