CSNK2A2 Rabbit Polyclonal Antibody

CAT#: TA335860

Rabbit Polyclonal Anti-CSNK2A2 Antibody

Product Images

WB Suggested Anti-CSNK2A2 Antibody Titration: 0.2-1 ug/ml; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CSNK2A2 Antibody: synthetic peptide directed towards the C terminal of human CSNK2A2. Synthetic peptide located within the following region: GTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: casein kinase 2 alpha 2
• Database Link:
  NP_001887
  Entrez Gene 1459 Human
  UniProt ID P19784
• Background: CSNK2A2 belongs to the protein kinase superfamily, Ser/Thr protein kinase family, CK2 subfamily. It contains 1 protein kinase domain. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. The alpha and alpha' chains contain the catalytic site. CSNK2A2 participates in Wnt signaling. It phosphorylates 'Ser-392' of p53/TP53 following UV irradiation.
• Synonyms: CK2A2; CK2alpha; CK2alpha'; CSNK2A1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 77%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Adherens junction, Tight junction, Wnt signaling pathway