B3GALNT1 Rabbit Polyclonal Antibody

CAT#: TA336005

Rabbit Polyclonal Anti-B3GALNT1 Antibody

Product Images

WB Suggested Anti-B3GALNT1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human Stomach

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-B3GALNT1 Antibody: synthetic peptide directed towards the middle region of human B3GALNT1. Synthetic peptide located within the following region: PRIYEMMGHVKPIKFEDVYVGICLNLLKVNIHIPEDTNLFFLYRIHLDVC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: beta-1,3-N-acetylgalactosaminyltransferase 1 (globoside blood group)
• Database Link:
  NP_001033717
  Entrez Gene 8706 Human
  UniProt ID O75752
• Background: This gene is a member of the beta-1,3-galactosyltransferase (beta3GalT) gene family. B3GALNT1 is type II membrane-bound glycoproteins with diverse enzymatic functions using different donor substrates (UDP-galactose and UDP-N-acetylglucosamine) and differe
• Synonyms: B3GALT3; beta3Gal-T3; galT3; Gb4Cer; GLCT3; GLOB; P; P1
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%; Rabbit: 79%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Glycosphingolipid biosynthesis - globo series, Metabolic pathways