Cyb5r2 Rabbit Polyclonal Antibody

CAT#: TA336093

Rabbit Polyclonal Anti-Cyb5r2 Antibody

Product Images

WB Suggested Anti-Cyb5r2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Rat Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Cyb5r2 Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: WEYSSGFITADMIKEHLPPPGEATLILVCGPPPLIQEAAHPSLEQLGYTK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 30 kDa
• Gene Name: cytochrome b5 reductase 2
• Database Link:
  NP_001014266
  Entrez Gene 365345 Rat
  UniProt ID Q6AY12
• Background: NADH-cytochrome b5 reductases are involved in desaturation and elongation of fatty acids, cholesterol biosynthesis, drug metabolism, and, in erythrocyte, methemoglobin reduction. Cyb5r2 is responsible for NADH-dependent lucigenin chemiluminescence in spermatozoa by reducing both lucigenin and 2-[4-iodophenyl]-3-[4-nitrophenyl]-5-[2,4-disulfophenyl]-2H tetrazolium monosodium salt (WST-1).
• Synonyms: B5R.2
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Rabbit: 100%; Dog: 92%; Pig: 92%; Mouse: 92%; Bovine: 92%; Guinea pig: 92%; Horse: 85%