Cezanne (OTUD7B) Rabbit Polyclonal Antibody

CAT#: TA337240

Rabbit Polyclonal Anti-OTUD7B Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "OTUD7B"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZA20D1 antibody: synthetic peptide directed towards the middle region of human ZA20D1. Synthetic peptide located within the following region: WKGGKEEAAGDGPVSEKPPAESVGNGGSKYSQEVMQSLSILRTAMQGEGK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 94 kDa
Gene Name OTU deubiquitinase 7B
Background The ZA20D1 gene encodes an enzyme that cleaves ubiquitin from proteins. This gene has the ability to down-regulate NF-kappa B which plays a pivotal role in inflammatory processes through induction of adhesion molecules and chemokines.
Synonyms CEZANNE; ZA20D1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Horse: 93%; Rabbit: 93%; Guinea pig: 93%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.