Cezanne (OTUD7B) Rabbit Polyclonal Antibody

CAT#: TA337241

Rabbit Polyclonal Anti-OTUD7B Antibody

Product Images

WB Suggested Anti-OTUD7B Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: 293T cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-OTUD7B antibody: synthetic peptide directed towards the middle region of human OTUD7B. Synthetic peptide located within the following region: VGTLKMGHRHQYQEEMIQRYLSDAEERFLAEQKQKEAERKIMNGGIGGGP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 92 kDa
• Gene Name: OTU deubiquitinase 7B
• Database Link:
  NP_064590
  Entrez Gene 56957 Human
  UniProt ID Q6GQQ9
• Background: The ZA20D1 (OTUD7B) gene encodes an enzyme that cleaves ubiquitin from proteins. This gene has the ability to down-regulate NF-kappa B which plays a pivotal role in inflammatory processes through induction of adhesion molecules and chemokines.
• Synonyms: CEZANNE; ZA20D1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 83%