LRRC38 Rabbit Polyclonal Antibody

CAT#: TA337420

Rabbit Polyclonal Anti-LRRC38 Antibody

Product Images

Host: Rabbit; Target Name: LRRC38; Sample Tissue: Placenta lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-LRRC38 antibody is: synthetic peptide directed towards the C-terminal region of Human LRRC38. Synthetic peptide located within the following region: LTDLCIIIFSGVAVSIAAIISSFFLATVVQCLQRCAPNKDAEDEDEDKDD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: leucine rich repeat containing 38
• Database Link:
  NP_001010847
  Entrez Gene 126755 Human
  UniProt ID Q5VT99
• Background: LRRC38 is an auxiliary protein of the large-conductance, voltage and calcium-activated potassium channel (BK alpha). It modulates gating properties by producing a marked shift in the BK channel's voltage dependence of activation in the hyperpolarizing direction, and in the absence of calcium.
• Synonyms: RP4-597A16.1
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Guinea pig: 93%; Zebrafish: 90%; Rat: 86%; Mouse: 86%; Rabbit: 86%; Yeast: 82%

Reference Data

• Protein Families: Transmembrane