LRRC38 Rabbit Polyclonal Antibody

CAT#: TA337420

Rabbit Polyclonal Anti-LRRC38 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "LRRC38"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-LRRC38 antibody is: synthetic peptide directed towards the C-terminal region of Human LRRC38. Synthetic peptide located within the following region: LTDLCIIIFSGVAVSIAAIISSFFLATVVQCLQRCAPNKDAEDEDEDKDD
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 29 kDa
Gene Name leucine rich repeat containing 38
Background LRRC38 is an auxiliary protein of the large-conductance, voltage and calcium-activated potassium channel (BK alpha). It modulates gating properties by producing a marked shift in the BK channel's voltage dependence of activation in the hyperpolarizing direction, and in the absence of calcium.
Synonyms RP4-597A16.1
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Guinea pig: 93%; Zebrafish: 90%; Rat: 86%; Mouse: 86%; Rabbit: 86%; Yeast: 82%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.