NUP62 Rabbit Polyclonal Antibody

CAT#: TA337476

Rabbit Polyclonal Anti-NUP62 Antibody

Product Images

Host: Rabbit; Target Name: NUP62; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0 ug/ml; NUP62 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-NUP62 antibody is: synthetic peptide directed towards the middle region of Human NUP62. Synthetic peptide located within the following region: TAPPGPGAAAGAAASSAMTYAQLESLINKWSLELEDQERHFLQQATQVNA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: nucleoporin 62kDa
• Database Link:
  NP_714941
  Entrez Gene 23636 Human
  UniProt ID P37198
• Background: The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. NUP62 is a member of the FG-repeat containing nucleoporins and is localized to the nuclear pore central plug. This protein associates with the importin alpha/beta complex which is involved in the import of proteins containing nuclear localization signals.
• Synonyms: IBSN; p62; SNDI
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 85%; Pig: 85%; Rat: 77%; Horse: 77%; Mouse: 77%; Guinea pig: 77%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors