SEC24C Rabbit Polyclonal Antibody

CAT#: TA337711

Rabbit Polyclonal Anti-SEC24C Antibody

Product Images

Host: Rabbit; Target Name: SEC24C; Sample Tissue: U937 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SEC24C antibody is: synthetic peptide directed towards the N-terminal region of Human SEC24C. Synthetic peptide located within the following region: AVDFFGAFYMSNTTDVELAGLDGDKTVTVEFKHDDRLNEESGALLQCALL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: SEC24 homolog C, COPII coat complex component
• Database Link:
  NP_940999
  Entrez Gene 9632 Human
  UniProt ID P53992
• Background: The function of this protein remains unknown.
• Synonyms: KIAA0079
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 86%