Mimitin (NDUFAF2) Rabbit Polyclonal Antibody

CAT#: TA337768

Rabbit Polyclonal Anti-NDUFAF2 Antibody

Product Images

WB Suggested Anti-NDUFAF2 Antibody; Titration: 1.0 ug/ml; Positive Control: MCF7 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NDUFAF2 antibody is: synthetic peptide directed towards the N-terminal region of Human NDUFAF2. Synthetic peptide located within the following region: HVGTDQFGNKYYYIPQYKNWRGQTIREKRIVEAANKKEVDYEAGDIPTEW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: NADH:ubiquinone oxidoreductase complex assembly factor 2
• Database Link:
  NP_777549
  Entrez Gene 91942 Human
  UniProt ID Q8N183
• Background: NADH:ubiquinone oxidoreductase (complex I) catalyzes the transfer of electrons from NADH to ubiquinone (coenzyme Q) in the first step of the mitochondrial respiratory chain, resulting in the translocation of protons across the inner mitochondrial membrane. This gene encodes a complex I assembly factor. Mutations in this gene cause progressive encephalopathy resulting from mitochondrial complex I deficiency.
• Synonyms: B17.2L; mimitin; MMTN; NDUFA12L
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Bovine: 86%