RNF23 (TRIM39) Rabbit Polyclonal Antibody

CAT#: TA337804

Rabbit Polyclonal Anti-TRIM39 Antibody

Product Images

WB Suggested Anti-TRIM39 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:12500; Positive Control: HepG2 cell lysateTRIM39 is supported by BioGPS gene expression data to be expressed in HepG2

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRIM39 antibody: synthetic peptide directed towards the N terminal of human TRIM39. Synthetic peptide located within the following region: HTVVPLDDATQEYKEKLQKCLEPLEQKLQEITRCKSSEEKKPGELKRLVE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: tripartite motif containing 39
• Database Link:
  NP_742013
  Entrez Gene 56658 Human
  UniProt ID Q9HCM9
• Background: The protein encoded by TRIM39 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The function of this protein has not been identified. This gene lies within the major histocompatibility complex class I region on chromosome 6.
• Synonyms: RNF23; TFP; TRIM39B
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%

Reference Data

• Protein Families: Druggable Genome