ACMSD Rabbit Polyclonal Antibody

CAT#: TA337920

Rabbit Polyclonal Anti-ACMSD Antibody

Product Images

WB Suggested Anti-ACMSD Antibody Titration: 0.2-1 ug/ml; Positive Control: Human kidney

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ACMSD antibody: synthetic peptide directed towards the middle region of human ACMSD. Synthetic peptide located within the following region: NPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: aminocarboxymuconate semialdehyde decarboxylase
• Database Link:
  NP_612199
  Entrez Gene 130013 Human
  UniProt ID Q8TDX5
• Background: The neuronal excitotoxin quinolinate is an intermediate in the de novo synthesis pathway of NAD from tryptophan, and has been implicated in the pathogenesis of several neurodegenerative disorders. Quinolinate is derived from alpha-amino-beta-carboxy-muconate-epsilon-semialdehyde (ACMS). ACMSD (ACMS decarboxylase; EC 4.1.1.45) can divert ACMS to a benign catabolite and thus prevent the accumulation of quinolinate from ACMS. [supplied by OMIM, Oct 2004]. ##Evidence-Data-START## Transcript exon combination :: BC107420.1, AB071418.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025084 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
• Synonyms: 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase; aminocarboxymuconate semialdehyde decarboxylase; OTTHUMP00000162500
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 93%; Guinea pig: 85%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Metabolic pathways, Tryptophan metabolism