GPR84 Rabbit Polyclonal Antibody

CAT#: TA338025

Rabbit Polyclonal Anti-GPR84 Antibody

Product Images

WB Suggested Anti-GPR84 Antibody; Titration: 1.0 ug/ml; Positive Control: Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GPR84 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR84. Synthetic peptide located within the following region: ATTQTLEGDSSEVGDQINSKRAKQMAEKSPPEASAKAQPIKGARRAPDSS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: G protein-coupled receptor 84
• Database Link:
  NP_065103
  Entrez Gene 53831 Human
  UniProt ID Q9NQS5
• Background: GPR84 is a receptor for medium-chain free fatty acid (FFA) with carbon chain lengths of C9 to C14. Capric acid (C10:0), undecanoic acid (C11:0) and lauric acid (C12:0) are the most potent agonists. GPR84 is not activated by short-chain and long-chain saturated and unsaturated FFAs. Activation by medium-chain free fatty acid is coupled to a pertussis toxin sensitive G(i/o) protein pathway. GPR84 may have important roles in processes from fatty acid metabolism to regulation of the immune system.
• Synonyms: EX33; GPCR4
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane