START domain containing 7 (STARD7) Rabbit Polyclonal Antibody

CAT#: TA338027

Rabbit Polyclonal Anti-STARD7 Antibody

Product Images

WB Suggested Anti-STARD7 Antibody; Titration: 1.0 ug/ml; Positive Control: HT1080 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-STARD7 antibody is: synthetic peptide directed towards the N-terminal region of Human STARD7. Synthetic peptide located within the following region: SINEMKRLEEMSNMFQSSGVQHHPPEPKAQTEGNEDSEGKEQRWEMVMDK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: StAR related lipid transfer domain containing 7
• Database Link:
  NP_064536
  Entrez Gene 56910 Human
  UniProt ID Q9NQZ5
• Background: Although the function of this gene is not known, its existence is supported by mRNA and EST data. The predicted gene product contains a region similar to the STAR-related lipid transfer (START) domain, which is often present in proteins involved in the cell signaling mediated by lipid binding. Alternatively spliced transcript variants have been described, although some transcripts occur only in cancer cell lines.
• Synonyms: GTT1
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%; Dog: 79%; Horse: 79%