SIRPG Rabbit Polyclonal Antibody

CAT#: TA338033

Rabbit Polyclonal Anti-SIRPG Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "SIRPG"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SIRPG antibody is: synthetic peptide directed towards the middle region of Human SIRPG. Synthetic peptide located within the following region: MDFSIRISSITPADVGTYYCVKFRKGSPENVEFKSGPGTEMALGAKPSA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 30 kDa
Gene Name signal regulatory protein gamma
Background The protein encoded by this gene is a member of the signal-regulatory protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins known to be involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes. Alternatively spliced transcript variants encoding different isoforms have been described.
Synonyms bA77C3.1; CD172g; SIRP-B2; SIRPB2; SIRPgamma
Note Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Horse: 85%
Reference Data
Protein Families Druggable Genome, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.