GPR7 (NPBWR1) Rabbit Polyclonal Antibody

CAT#: TA338160

Rabbit Polyclonal Anti-NPBWR1 Antibody

Product Images

WB Suggested Anti-NPBWR1 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NPBWR1 antibody is: synthetic peptide directed towards the N-terminal region of Human NPBWR1. Synthetic peptide located within the following region: FSEPWPANASGPDPALSCSNASTLAPLPAPLAVAVPVVYAVICAVGLAGN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: neuropeptides B/W receptor 1
• Database Link:
  NP_005276
  Entrez Gene 2831 Human
  UniProt ID P48145
• Background: NPBWR1 interacts specifically with a number of opioid ligands. NPBWR1 is a receptor for neuropeptides B and W, which may be involved in neuroendocrine system regulation, food intake and the organization of other signals. NPBWR1 has a higher affinity for neuropeptide B.
• Synonyms: GPR7
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane
• Protein Pathways: Neuroactive ligand-receptor interaction