IGFBP4 Rabbit Polyclonal Antibody

CAT#: TA338268

Rabbit Polyclonal Anti-IGFBP4 Antibody

Product Images

WB Suggested Anti-IGFBP4 Antibody Titration: 1 ug/ml; Positive Control: Fetal Brain Lysate

• 

  Immunohistochemistry with Human Prostate lysate tissue at an antibody concentration of 5.0 ug/ml using anti-IGFBP4 antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IGFBP4 antibody: synthetic peptide directed towards the middle region of human IGFBP4. Synthetic peptide located within the following region: RALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 26 kDa
• Gene Name: insulin like growth factor binding protein 4
• Database Link:
  NP_001543
  Entrez Gene 16010 MouseEntrez Gene 3487 Human
  UniProt ID P22692
• Background: This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma in both glycosylated and non-glycosylated forms. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. [provided by RefSeq, Jul 2008]
• Synonyms: BP-4; HT29-IGFBP; IBP4; IGFBP-4
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Secreted Protein