Filamin C (FLNC) Rabbit Polyclonal Antibody

CAT#: TA338310

Rabbit Polyclonal Anti-FLNC Antibody

Product Images

WB Suggested Anti-FLNC Antibody; Titration: 1.0 ug/ml; Positive Control: HepG2 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FLNC antibody is: synthetic peptide directed towards the N-terminal region of Human FLNC. Synthetic peptide located within the following region: VGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 296 kDa
• Gene Name: filamin C
• Database Link:
  NP_001120959
  Entrez Gene 2318 Human
  UniProt ID Q14315
• Background: This gene encodes one of three related filamin genes, specifically gamma filamin. These filamin proteins crosslink actin filaments into orthogonal networks in cortical cytoplasm and participate in the anchoring of membrane proteins for the actin cytoskeleton. Three functional domains exist in filamin: an N-terminal filamentous actin-binding domain, a C-terminal self-association domain, and a membrane glycoprotein-binding domain. Two transcript variants encoding different isoforms have been found for this gene.
• Synonyms: ABP-280; ABP280A; ABPA; ABPL; CMH26; FLN2; MFM5; MPD4; RCM5
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Pathways: Focal adhesion, MAPK signaling pathway