FAM38B (PIEZO2) Rabbit Polyclonal Antibody

CAT#: TA338481

Rabbit Polyclonal Anti-PIEZO2 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "PIEZO2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PIEZO2antibody: synthetic peptide directed towards the middle region of human FAM38B. Synthetic peptide located within the following region: AGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENNFMDITIILS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 81 kDa
Gene Name piezo type mechanosensitive ion channel component 2
Background PIEZO2is a multi-pass membrane proteinPotential. It belongs to the FAM38 family.The exact function of PIEZO2remains unknown.
Synonyms C18orf30; C18orf58; DA3; DA5; FAM38B; FAM38B2; HsT748; HsT771; MWKS
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.