GABRE Rabbit Polyclonal Antibody

CAT#: TA338544

Rabbit Polyclonal Anti-GABRE Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "GABRE"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-GABRE antibody: synthetic peptide directed towards the N terminal of human GABRE. Synthetic peptide located within the following region: DVVYGPQPQPLENQLLSEETKSTETETGSRVGKLPEASRILNTILSNYDH
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 56 kDa
Gene Name gamma-aminobutyric acid type A receptor epsilon subunit
Background The product of this gene belongs to the ligand-gated ionic channel (TC 1.A.9) family. It encodes the gamma-aminobutyric acid (GABA) A receptor which is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes an epsilon subunit. It is mapped to chromosome Xq28 in a cluster comprised of genes encoding alpha 3, beta 4 and theta subunits of the same receptor. Alternatively spliced transcript variants have been identified, but only one is thought to encode a protein. [provided by RefSeq, Oct 2008]
Synonyms epsilon; GABA(A) receptor; gamma-aminobutyric acid (GABA) A receptor; OTTHUMP00000025892
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 93%; Mouse: 86%; Pig: 85%; Guinea pig: 85%
Reference Data
Protein Families Druggable Genome, Ion Channels: Cys-loop Receptors, Transmembrane
Protein Pathways Neuroactive ligand-receptor interaction

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.