CASD1 Rabbit Polyclonal Antibody

CAT#: TA338625

Rabbit Polyclonal Anti-CASD1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "CASD1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CASD1 antibody: synthetic peptide directed towards the N terminal of human CASD1. Synthetic peptide located within the following region: MAALAYNLGKREINHYFSVRSAKVLALVAVLLLAACHLASRRYRGNDSCE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 91 kDa
Gene Name CAS1 domain containing 1
Background The function of this protein remains unknown.
Synonyms C7orf12; NBLA04196
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.