STEAP4 Rabbit Polyclonal Antibody

CAT#: TA338663

Rabbit Polyclonal Anti-STEAP4 Antibody

Product Images

WB Suggested Anti-STEAP4 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-STEAP4 antibody: synthetic peptide directed towards the C terminal of human STEAP4. Synthetic peptide located within the following region: AFLHVLYTLVIPIRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSDSYVA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: STEAP4 metalloreductase
• Database Link:
  NP_078912
  Entrez Gene 79689 Human
  UniProt ID Q687X5
• Background: Metalloreductase has the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1+). It uses NAD(+) as acceptor.
• Synonyms: STAMP2; TIARP; TNFAIP9
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Bovine: 83%

Reference Data

• Protein Families: Druggable Genome, Transmembrane