ELOVL7 Rabbit Polyclonal Antibody

CAT#: TA338690

Rabbit Polyclonal Anti-ELOVL7 Antibody

Product Images

WB Suggested Anti-ELOVL7 Antibody Titration: 1.25 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ELOVL7 antibody: synthetic peptide directed towards the N terminal of human ELOVL7. Synthetic peptide located within the following region: MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: ELOVL fatty acid elongase 7
• Database Link:
  NP_079206
  Entrez Gene 79993 Human
  UniProt ID A1L3X0
• Background: ELOVL7 could be implicated in synthesis of very long chain fatty acids and sphingolipids.
• Synonyms: FLJ23563
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 93%; Rabbit: 93%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Transmembrane